PDB entry 5zh2

View 5zh2 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF PfKRS WITH INHIBITOR CLADO-5
Class: ligase
Keywords: krs, ligase-ligase inhibitor complex, ligase
Deposited on 2018-03-11, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-tRNA ligase
    Species: Plasmodium falciparum NF54 [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zh2a1, d5zh2a2
  • Chain 'B':
    Compound: Lysine-tRNA ligase
    Species: Plasmodium falciparum NF54 [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zh2b1, d5zh2b2
  • Heterogens: 9CU, LYS, CL, MPO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zh2A (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zh2A (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmteiryrqryldllinessrhtfvtrtkiinflr
    nflnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidkv
    yeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynk
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekmiptaaklldqlashfien
    kyndkpffivehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfs
    afctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zh2B (B:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zh2B (B:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdgehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmteiryrqryldllinessrhtfvtrtkiinflrnfl
    nergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidkvyei
    gkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgp
    enqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnppta
    aklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnay
    telndpfkqdsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp