PDB entry 5zgp

View 5zgp on RCSB PDB site
Description: Crystal structure of NDM-1 at pH6.2 (Bis-Tris) in complex with hydrolyzed ampicillin
Class: hydrolase/antibiotic
Keywords: NDM-1, metallo-beta-lactamase, antibiotic resistent, conformational change, HYDROLASE-ANTIBIOTIC complex
Deposited on 2018-03-10, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zgpa_
  • Chain 'B':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zgpb_
  • Heterogens: ZN, ZZ7, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zgpA (A:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgpA (A:)
    eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
    dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
    pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
    ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zgpB (B:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgpB (B:)
    eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
    dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
    pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
    ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    r