PDB entry 5zgm

View 5zgm on RCSB PDB site
Description: Crystal Structure of Parvalbumin SPVI, the Major Allergens in Mustelus griseus
Class: allergen
Keywords: Parvalbumin, food allergen, ALLERGEN
Deposited on 2018-03-09, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parvalbumin SPVI
    Species: Triakis semifasciata [TaxId:30493]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZGM (Start-109)
    Domains in SCOPe 2.07: d5zgma_
  • Chain 'B':
    Compound: Parvalbumin SPVI
    Species: Triakis semifasciata [TaxId:30493]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZGM (Start-109)
    Domains in SCOPe 2.07: d5zgmb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zgmA (A:)
    mpmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfie
    eeelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgmA (A:)
    pmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfiee
    eelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zgmB (B:)
    mpmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfie
    eeelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgmB (B:)
    pmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfiee
    eelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa