PDB entry 5zgf

View 5zgf on RCSB PDB site
Description: Crystal structure of NDM-1 Q123G mutant
Class: hydrolase
Keywords: NDM-1, metallo-beta-lactamase, antibiotic resistent, conformational change, HYDROLASE
Deposited on 2018-03-08, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (Start-241)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5zgfa_
  • Heterogens: ZN, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zgfA (A:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahgdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgfA (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahgdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr