PDB entry 5zga

View 5zga on RCSB PDB site
Description: Crystal Structure of Triosephosphate isomerase SAD deletion and N115A mutant from Opisthorchis viverrini
Class: isomerase
Keywords: Tim-barrel, Triosephosphate isomerase, ISOMERASE
Deposited on 2018-03-08, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.7900000000000003 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-268)
      • conflict (65)
      • conflict (123)
      • engineered mutation (134)
      • conflict (210)
      • conflict (222)
    Domains in SCOPe 2.08: d5zgaa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-268)
      • conflict (65)
      • conflict (123)
      • engineered mutation (134)
      • conflict (210)
      • conflict (222)
    Domains in SCOPe 2.08: d5zgab_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-268)
      • conflict (65)
      • conflict (123)
      • engineered mutation (134)
      • conflict (210)
      • conflict (222)
    Domains in SCOPe 2.08: d5zgac_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-268)
      • conflict (65)
      • conflict (123)
      • engineered mutation (134)
      • conflict (210)
      • conflict (222)
    Domains in SCOPe 2.08: d5zgad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zgaA (A:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektahaisagvnviacigekleereagkteevcfrqmeairknlsmwnh
    iviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaancrt
    lakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgaA (A:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
    iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaktateqqaqevhla
    vrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieicnan
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zgaB (B:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektahaisagvnviacigekleereagkteevcfrqmeairknlsmwnh
    iviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaancrt
    lakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgaB (B:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
    iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaigtgktateqqaqe
    vhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfiei
    cnana
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zgaC (C:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektahaisagvnviacigekleereagkteevcfrqmeairknlsmwnh
    iviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaancrt
    lakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgaC (C:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
    iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaktateqqaqevhla
    vrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieicnan
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zgaD (D:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektahaisagvnviacigekleereagkteevcfrqmeairknlsmwnh
    iviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaancrt
    lakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zgaD (D:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
    iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaigtgktateqqaqe
    vhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfiei
    cnana