PDB entry 5zg8

View 5zg8 on RCSB PDB site
Description: Crystal Structure of TtNRS
Class: ligase
Keywords: GlnRS, QRS, Ligase, Synthetase
Deposited on 2018-03-08, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asparagine--tRNA ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zg8a1, d5zg8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zg8A (A:)
    mrvfideiarhvdqevelrgwlyqrrskgkihflilrdgtgflqatvvqgevpeavfrea
    dhlpqetalrvwgrvredrrapggfelavrdlqvvsrpqgeypigpkehgidflmdhrhl
    wlrhrrpfavmrirdeleraiheffgergflrfdapiltpsavegttelfevelfdgeka
    ylsqsgqlyaeagalafakvytfgptfraersktrrhllefwmvepevafmtheenmalq
    eelvsflvarvlerrsrelemlgrdpkalepaaeghyprltykeavalvnriaqedpevp
    plpygedfgapheaalsrrfdrpvfveryparikafymepdpedpelvlnddllapegyg
    eiiggsqrihdlellrrkiqefglpeevydwyldlrrfgsvphsgfglglertvawicgl
    ahvreaipfprmytrmrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg8A (A:)
    mrvfideiarhvdqevelrgwlyqrrskgkihflilrdgtgflqatvvqgevpeavfrea
    dhlpqetalrvwgrvredrrapggfelavrdlqvvsrpqgeypigpkehgidflmdhrhl
    wlrhrrpfavmrirdeleraiheffgergflrfdapiltplfevelfdgekaylsqsgql
    yaeagalafakvytfgptfrhllefwmvepevafmtheenmalqeelvsflvarvlerrs
    relemlgrdpkalepaaeghyprltykeavalvnriaqedpevpplpygedfgapheaal
    srrfdrpvfveryparikafymepdpedpelvlnddllapegygeiiggsqrihdlellr
    rkiqefglpeevydwyldlrrfgsvphsgfglglertvawicglahvreaipfprmytrm
    rp