PDB entry 5zg6

View 5zg6 on RCSB PDB site
Description: Crystal structure of beta-lactamase PenP mutant-E166Y in complex with cephaloridine as "post-acylation" intermediate
Class: hydrolase
Keywords: class A beta-lactamase, antibiotic resistance, HYDROLASE
Deposited on 2018-03-07, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • engineered mutation (140)
    Domains in SCOPe 2.07: d5zg6a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • engineered mutation (140)
    Domains in SCOPe 2.07: d5zg6b_
  • Heterogens: CED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zg6A (A:)
    gpmktemkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqq
    ksiedlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggp
    eslkkelrkigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekre
    llidwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssr
    dkkdakyddkliaeatkvvmkalnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg6A (A:)
    ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
    kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
    nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvmkaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zg6B (B:)
    gpmktemkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqq
    ksiedlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggp
    eslkkelrkigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekre
    llidwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssr
    dkkdakyddkliaeatkvvmkalnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg6B (B:)
    ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
    kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
    nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvmkaln