PDB entry 5zg3

View 5zg3 on RCSB PDB site
Description: Crystal structure of the GluA2o LBD in complex with glutamate and TAK-137
Class: transport protein
Keywords: ampa receptor ligand-binding domain, allosteric modulation complex, membrane protein, transport protein
Deposited on 2018-03-07, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3a_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3b_
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3c_
  • Chain 'D':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • expression tag (0-1)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3d1, d5zg3d2
  • Chain 'E':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3e_
  • Chain 'F':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (2-116)
      • linker (117-118)
    • Uniprot P42262 (119-End)
    Domains in SCOPe 2.07: d5zg3f_
  • Heterogens: 9C6, GLU, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zg3A (A:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3A (A:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
    eqglldklknkwwydkgecg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zg3B (B:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3B (B:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
    eqglldklknkwwydkgecg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zg3C (C:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3C (C:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
    eqglldklknkwwydkgecg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zg3D (D:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3D (D:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zg3E (E:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3E (E:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
    eqglldklknkwwydkgecg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zg3F (F:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg3F (F:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
    eqglldklknkwwydkgecg