PDB entry 5zg2

View 5zg2 on RCSB PDB site
Description: Crystal structure of the GluA2o LBD in complex with ZK200775 and Compound-2
Class: transport protein
Keywords: ampa receptor ligand-binding domain, allosteric modulation complex, membrane protein, transport protein
Deposited on 2018-03-07, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (Start-115)
      • linker (116-117)
    • Uniprot P42262 (118-End)
      • linker (118)
    Domains in SCOPe 2.07: d5zg2a_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (Start-115)
      • linker (116-117)
    • Uniprot P42262 (118-End)
      • linker (118)
    Domains in SCOPe 2.07: d5zg2b_
  • Heterogens: ZK1, 9C0, ZN, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zg2A (A:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg2A (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlklne
    qglldklknkwwydkgecg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zg2B (B:)
    gsnktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zg2B (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlklne
    qglldklknkwwydkgecg