PDB entry 5zfx

View 5zfx on RCSB PDB site
Description: Crystal Structure of Triosephosphate isomerase from Opisthorchis viverrini
Class: isomerase
Keywords: Tim-barrel, Triosephosphate isomerase, ISOMERASE
Deposited on 2018-03-07, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-271)
      • conflict (65)
      • conflict (123)
      • conflict (213)
      • conflict (225)
    Domains in SCOPe 2.08: d5zfxa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-271)
      • conflict (65)
      • conflict (123)
      • conflict (213)
      • conflict (225)
    Domains in SCOPe 2.08: d5zfxb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-271)
      • conflict (65)
      • conflict (123)
      • conflict (213)
      • conflict (225)
    Domains in SCOPe 2.08: d5zfxc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Opisthorchis viverrini [TaxId:6198]
    Gene: T265_10017
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A074Z863 (Start-271)
      • conflict (65)
      • conflict (123)
      • conflict (213)
      • conflict (225)
    Domains in SCOPe 2.08: d5zfxd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zfxA (A:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektnhaisagvnviacigekleereagkteevcfrqmeairknlssadm
    wnhiviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaan
    crtlakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfxA (A:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
    iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwaktateqqaqev
    hlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieic
    nana
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zfxB (B:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektnhaisagvnviacigekleereagkteevcfrqmeairknlssadm
    wnhiviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaan
    crtlakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfxB (B:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
    iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwaigtgktateqq
    aqevhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdf
    ieicnana
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zfxC (C:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektnhaisagvnviacigekleereagkteevcfrqmeairknlssadm
    wnhiviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaan
    crtlakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfxC (C:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
    iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwatateqqaqevh
    lavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieicn
    ana
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zfxD (D:)
    mgsshhhhhhssglvprgshmptdrkffvggnwkmngskkendkliemlthakidpntev
    lvappalylpsvrekldkrfhvaaqncykvpsgaftgevspamlkdvgcdwvilghserr
    hilletdqlvgektnhaisagvnviacigekleereagkteevcfrqmeairknlssadm
    wnhiviayepvwaigtgktateqqaqevhlavrrwmeekvspavaksiriiyggsvtaan
    crtlakqpdvdgflvggaslkpdfieicnana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zfxD (D:)
    rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
    qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
    iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwatateqqaqevh
    lavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieicn
    ana