PDB entry 5zft

View 5zft on RCSB PDB site
Description: Crystal structure of beta-lactamase PenP mutant-E166Y in complex with cephaloridine as "pre-deacylation" intermediate
Class: hydrolase
Keywords: class A beta-lactamase, antibiotic resistance, HYDROLASE
Deposited on 2018-03-07, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • engineered mutation (140)
    Domains in SCOPe 2.08: d5zfta_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • engineered mutation (140)
    Domains in SCOPe 2.08: d5zftb_
  • Heterogens: CED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zftA (A:)
    gpmktemkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqq
    ksiedlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggp
    eslkkelrkigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekre
    llidwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssr
    dkkdakyddkliaeatkvvmkalnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zftA (A:)
    ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
    kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
    nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvmkalnmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zftB (B:)
    gpmktemkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqq
    ksiedlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggp
    eslkkelrkigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekre
    llidwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssr
    dkkdakyddkliaeatkvvmkalnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zftB (B:)
    ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
    kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
    nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvmkalnm