PDB entry 5zfi

View 5zfi on RCSB PDB site
Description: Mouse kallikrein 7 in complex with 6-benzyl-1,4-diazepan-7-one derivative
Class: hydrolase
Keywords: protease, inhibitor complex, HYDROLASE
Deposited on 2018-03-06, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Mus musculus [TaxId:10090]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zfia_
  • Heterogens: 9C9, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zfiA (A:)
    iidgykckegshpwqvallkgnqlhcggvlvdkywvltaahckmgqyqvqlgsdkigdqs
    aqkikatksfrhpgystkthvndimlvrldepvkmsskveavqlpehceppgtsctvsgw
    gtttspdvtfpsdlmcsdvklissreckkvykdllgktmlcagipdsktntcngdsggpl
    vcndtlqglvswgtypcgqpndpgvytqvckykrwvmetmkthr