PDB entry 5zfh

View 5zfh on RCSB PDB site
Description: Mouse Kallikrein 7
Class: hydrolase
Keywords: protease, HYDROLASE
Deposited on 2018-03-06, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Mus musculus [TaxId:10090]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zfha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zfhA (A:)
    iidgykckegshpwqvallkgnqlhcggvlvdkywvltaahckmgqyqvqlgsdkigdqs
    aqkikatksfrhpgystkthvndimlvrldepvkmsskveavqlpehceppgtsctvsgw
    gtttspdvtfpsdlmcsdvklissreckkvykdllgktmlcagipdsktntcngdsggpl
    vcndtlqglvswgtypcgqpndpgvytqvckykrwvmetmkthr