PDB entry 5zf3

View 5zf3 on RCSB PDB site
Description: Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Co-crystallization, Xylotriose, HYDROLASE
Deposited on 2018-03-02, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) [TaxId:1344414]
    Gene: xyn2, M419DRAFT_124931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zf3a_
  • Heterogens: XYP, GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zf3A (A:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs