PDB entry 5zf2

View 5zf2 on RCSB PDB site
Description: Crystal structure of Trxlp from Edwardsiella tarda EIB202
Class: oxidoreductase
Keywords: Thioredoxin-like protein, T4SS effector, ASK1-MAPK signaling cascades., OXIDOREDUCTASE
Deposited on 2018-03-02, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin (H-type,TRX-H)
    Species: Edwardsiella tarda (strain EIB202) [TaxId:498217]
    Gene: ETAE_2186
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zf2a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5zf2A (A:)
svepysdaaftqaqasgapvlvdvyadwcpvckrqereltplfaqpaqrdlrvfkvnfdt
qkaalqqfrvsqqstlilyrngqevrrsigetspsalsdfltr