PDB entry 5zf1

View 5zf1 on RCSB PDB site
Description: Molecular structure of a novel 5,10-methylenetetrahydrofolate dehydrogenase from the silkworm, Bombyx mori
Class: oxidoreductase
Keywords: Lepidoptera, 5, 10-methylenetetrahydrofolate dehydrogenase, NADP+, Serine, OXIDOREDUCTASE
Deposited on 2018-03-02, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methylenetetrahydrofolate dehydrogenase
    Species: Bombyx mori [TaxId:7091]
    Gene: LOC101741628
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZF1 (0-End)
    Domains in SCOPe 2.07: d5zf1a1, d5zf1a2
  • Chain 'B':
    Compound: 5,10-methylenetetrahydrofolate dehydrogenase
    Species: Bombyx mori [TaxId:7091]
    Gene: LOC101741628
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZF1 (0-End)
    Domains in SCOPe 2.07: d5zf1b1, d5zf1b2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zf1A (A:)
    marildgkalameikkelkqkiaqwvslgnraptirciivgddpashtyvrnkveaakfv
    gidaltinrdsditeeqllseiqnlnednsvdgilvqlpvpdtinerrvcdaiapekdid
    gfhiinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhs
    dkrhesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidv
    gittrtdengksrlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqanks
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zf1A (A:)
    marildgkalameikkelkqkiaqwvslgnraptirciivgddhtyvrnkveaakfvgid
    altinrdsditeeqllseiqnlnednsvdgilvqlpvpdtinerrvcdaiapekdidgfh
    iinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhsdkr
    hesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidvgit
    trlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqank
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zf1B (B:)
    marildgkalameikkelkqkiaqwvslgnraptirciivgddpashtyvrnkveaakfv
    gidaltinrdsditeeqllseiqnlnednsvdgilvqlpvpdtinerrvcdaiapekdid
    gfhiinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhs
    dkrhesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidv
    gittrtdengksrlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqanks
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zf1B (B:)
    marildgkalameikkelkqkiaqwvslgnraptirciivgddpashtyvrnkveaakfv
    gidaltinrdsditeeqllseiqnlnednsvdgilvqlpvpdtinerrvcdaiapekdid
    gfhiinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhs
    dkrhesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidv
    gitrlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqank