PDB entry 5zew

View 5zew on RCSB PDB site
Description: A ubiquitin-like protein from the hyperthermophilic archaea Caldiarchaeum subterraneum
Class: structural protein
Keywords: ubiquitin-like protein, STRUCTURAL PROTEIN
Deposited on 2018-02-28, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1474, HGMM_F04B03C03, HGMM_F21D07C21, HGMM_F30C12C33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zewa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zewA (A:)
    mkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetles
    lgvadgdkfvlitrtvg