PDB entry 5zeq

View 5zeq on RCSB PDB site
Description: Carboxypeptidase B in complex with DD28
Class: hydrolase/inhibitor
Keywords: selenium, organoselenium, selenol, CPB inhibitor, selectivity, HYDROLASE-INHIBITOR complex
Deposited on 2018-02-27, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase b
    Species: Sus scrofa [TaxId:9823]
    Gene: CPB1, CPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zeqa_
  • Heterogens: ZN, 9B3, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zeqA (A:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl