PDB entry 5zeo

View 5zeo on RCSB PDB site
Description: X-ray structure of sperm whale V21C/V66C/F46S myoglobin mutant with an intramolecular disulfide bond
Class: oxygen transport
Keywords: myoglobin, sperm whale, OXYGEN TRANSPORT
Deposited on 2018-02-27, released 2018-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (65)
    Domains in SCOPe 2.08: d5zeoa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5zeoA (A:)
vlsegewqlvlhvwakveadcaghgqdilirlfkshpetlekfdrskhlkteaemkased
lkkhgctvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg