PDB entry 5zef

View 5zef on RCSB PDB site
Description: Crystal structure of Entamoeba histolytica Arginase in complex with L- Norvaline at 2.01 A
Class: hydrolase
Keywords: Entamoeba histolytica, Metalloenzyme, Inhibition, HYDROLASE
Deposited on 2018-02-27, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_152330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zefa_
  • Chain 'B':
    Compound: arginase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_152330
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LSS0 (16-End)
      • expression tag (14-15)
    Domains in SCOPe 2.07: d5zefb1, d5zefb2
  • Heterogens: NVA, MN, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zefA (A:)
    hhhhhhssgenlyfqsmqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaks
    vnkktitepktpqelgvtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgt
    iagvvkamkpnarvgvvwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyi
    tpkdimyvgirsidvgeqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsf
    didgidpefilgtgtpvpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknv
    lkcisslfgikc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zefA (A:)
    mqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaksvnkktitepktpqelg
    vtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgtiagvvkamkpnarvgv
    vwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyitpkdimyvgirsidvg
    eqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsfdidgidpefilgtgtp
    vpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknvlkcisslfgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zefB (B:)
    hhhhhhssgenlyfqsmqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaks
    vnkktitepktpqelgvtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgt
    iagvvkamkpnarvgvvwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyi
    tpkdimyvgirsidvgeqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsf
    didgidpefilgtgtpvpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknv
    lkcisslfgikc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zefB (B:)
    qsmqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaksvnkktitepktpqe
    lgvtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgtiagvvkamkpnarv
    gvvwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyitpkdimyvgirsid
    vgeqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsfdidgidpefilgtg
    tpvpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknvlkcisslfgik