PDB entry 5zed

View 5zed on RCSB PDB site
Description: Crystal structure of Kluyveromyces polyspora ADH (KpADH) mutant (E214V/T215S)
Class: isomerase
Keywords: Alcohol dehydrogenase(KpADH), NADPH, ISOMERASE
Deposited on 2018-02-27, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein ADH
    Species: Vanderwaltozyma polyspora DSM 70294 [TaxId:436907]
    Gene: Kpol_529p27
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7TM80 (0-341)
      • engineered mutation (213-214)
    Domains in SCOPe 2.07: d5zeda_
  • Chain 'B':
    Compound: Uncharacterized protein ADH
    Species: Vanderwaltozyma polyspora DSM 70294 [TaxId:436907]
    Gene: Kpol_529p27
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7TM80 (0-341)
      • engineered mutation (213-214)
    Domains in SCOPe 2.07: d5zedb_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zedA (A:)
    msvlisgasgyiakhivrvlleqnykvigtvrsqdkadkllkqynnpnlsyeivpeianl
    dafddifkkhgkeikyvihaaspvnfgakdlekdlvipaingtknmfeaikkyapdtver
    vvmtasyasimtphrqndptltldeetwnpvteenayenvftaycasktfaekeawkfvk
    ensdavkfklttihpsfvfgpqnfdedvtkklnvsceiingllhapfdtkvekthfsqfi
    dvrdvakthvlgfqkdelinqrlllcngafsqqdivnvfnedfpelkgqfppedkdtdln
    kgvtgckidnektkkllafeftpfhktihdtvyqilhkegrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zedB (B:)
    msvlisgasgyiakhivrvlleqnykvigtvrsqdkadkllkqynnpnlsyeivpeianl
    dafddifkkhgkeikyvihaaspvnfgakdlekdlvipaingtknmfeaikkyapdtver
    vvmtasyasimtphrqndptltldeetwnpvteenayenvftaycasktfaekeawkfvk
    ensdavkfklttihpsfvfgpqnfdedvtkklnvsceiingllhapfdtkvekthfsqfi
    dvrdvakthvlgfqkdelinqrlllcngafsqqdivnvfnedfpelkgqfppedkdtdln
    kgvtgckidnektkkllafeftpfhktihdtvyqilhkegrv