PDB entry 5ze9

View 5ze9 on RCSB PDB site
Description: Crystal structure of AMP-PNP bound mutant A3B3 complex from Enterococcus hirae V-ATPase
Class: hydrolase
Keywords: P-loop, HYDROLASE
Deposited on 2018-02-27, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type sodium ATPase catalytic subunit A
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpA, EHR_08260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08636 (7-End)
      • expression tag (6)
  • Chain 'B':
    Compound: V-type sodium ATPase catalytic subunit A
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpA, EHR_08260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08636 (7-End)
      • expression tag (6)
  • Chain 'C':
    Compound: V-type sodium ATPase catalytic subunit A
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpA, EHR_08260
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: V-type sodium ATPase subunit B
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpB, EHR_08265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08637
      • engineered mutation (71)
    Domains in SCOPe 2.07: d5ze9d1, d5ze9d2, d5ze9d3
  • Chain 'E':
    Compound: V-type sodium ATPase subunit B
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpB, EHR_08265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08637 (7-End)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d5ze9e1, d5ze9e2, d5ze9e3
  • Chain 'F':
    Compound: V-type sodium ATPase subunit B
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) [TaxId:768486]
    Gene: ntpB, EHR_08265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08637 (7-End)
      • expression tag (6)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d5ze9f1, d5ze9f2, d5ze9f3, d5ze9f4
  • Heterogens: ANP, MG, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ze9D (D:)
    gssgssgmikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkam
    vqifegtsginyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekylding
    evinpiardypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvlds
    sddfavvfaaigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaae
    ylayekgmhvlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirg
    lkgsvtqipiltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkd
    kgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyv
    nqgfytnrtitetldlgwellamlprtelkrikddlldkylpegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ze9D (D:)
    keyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsg
    inyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiard
    ypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfa
    aigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmh
    vlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqip
    iltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkdkgtgagktr
    edhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyvnqgfytnrt
    itetldlgwellamlprtelkrikddlldkylp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ze9E (E:)
    gssgssgmikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkam
    vqifegtsginyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekylding
    evinpiardypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvlds
    sddfavvfaaigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaae
    ylayekgmhvlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirg
    lkgsvtqipiltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkd
    kgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyv
    nqgfytnrtitetldlgwellamlprtelkrikddlldkylpegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ze9E (E:)
    mikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegt
    sginyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpia
    rdypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavv
    faaigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekg
    mhvlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirglkgsvtq
    ipiltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkdkgtgagk
    tredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyvnqgfytn
    rtitetldlgwellamlprtelkrikddlldkylp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ze9F (F:)
    gssgssgmikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkam
    vqifegtsginyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekylding
    evinpiardypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvlds
    sddfavvfaaigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaae
    ylayekgmhvlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirg
    lkgsvtqipiltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkd
    kgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyv
    nqgfytnrtitetldlgwellamlprtelkrikddlldkylpegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ze9F (F:)
    gmikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifeg
    tsginyknssvrflghplqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpi
    ardypdefiqtgisaidhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfav
    vfaaigitfeeaeffmedfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayek
    gmhvlvimtdmtnyaealreisaarrevpgrrgypgylytnlatlferagrirglkgsvt
    qipiltmpeddkthpipdltgyitegqiiltrelyksgiqppidvlpslsrlkdkgtgag
    ktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfeneyvnqgfyt
    nrtitetldlgwellamlprtelkrikddlldkylp