PDB entry 5zds

View 5zds on RCSB PDB site
Description: Crystal structure of the second PDZ domain of Frmpd2
Class: signaling protein
Keywords: Frmpd2, PDZ, SIGNALING PROTEIN
Deposited on 2018-02-24, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FERM and PDZ domain-containing 2
    Species: Mus musculus [TaxId:10090]
    Gene: Frmpd2, Gm626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zdsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zdsA (A:)
    gsqtntgeiyfvelvkedgtlgfsvtggintsvphggiyvksiipggpaakegqilqgdr
    llqvdgvslcglthkqavqclkgpgqvarlvlerrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zdsA (A:)
    eiyfvelvkedgtlgfsvtggintsvphggiyvksiipggpaakegqilqgdrllqvdgv
    slcglthkqavqclkgpgqvarlvlerr