PDB entry 5zdk

View 5zdk on RCSB PDB site
Description: Crystal Structure Analysis of TtQRS in complex with ATP
Class: ligase
Keywords: GlnRS, QRS, Ligase, Synthetase
Deposited on 2018-02-23, released 2018-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamine--tRNA ligase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: TTHA0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zdka1, d5zdka2
  • Heterogens: ATP, CS, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zdkA (A:)
    mglvpecfitelverdlkegkyaklvtrfppepngylhigharsivlnfglaqdyggecn
    lrfddtnpetekeeyaraieedvrwlgfrptrvlyasdyfetmyqcalvliqegkayvdd
    lpeeemselraqgkpspyrersveenlelfermrrgefptgsrvlrakidpahpnfklrd
    pvlyrivhaphyhvgdrwviypmydfahpledfiegvthslctlefennrtvydwvienl
    kgkcglptsprphqyefarldlshtvlskrkliklveggyvsgwddprlptlrglrrrgv
    rpeaivefvrktgisrneaqiemdlfeevvrddlnpiaprvlgvvdplkvvltnyegeew
    ieapywprdipkegtrplpfspelyiertdfslnppkgwkrlapgqrvrlrhayvieled
    vveeggevrllkarivpgtlganpedgvrpkgvihwvsarhalpvefrlygrlfrtkdpe
    eggdflqnlnpealvvkrgfiepsvaqdpedtryqlerlgyfwrdpvdsrpealvmnriv
    plkegyrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zdkA (A:)
    mglvpecfitelverdlkegkyaklvtrfppepngylhigharsivlnfglaqdyggecn
    lrfddtnpetekeeyaraieedvrwlgfrptrvlyasdyfetmyqcalvliqegkayvdd
    lpeeemselraqgkpspyrersveenlelfermrrgefptgsrvlrakidpahpnfklrd
    pvlyrivhaphyhvgdrwviypmydfahpledfiegvthslctlefennrtvydwvienl
    kgkcglptsprphqyefarldlshtvlskrkliklveggyvsgwddprlptlrglrrrgv
    rpeaivefvrktgisrneaqiemdlfeevvrddlnpiaprvlgvvdplkvvltnyegeew
    ieapywprdipkegtrplpfspelyiertdfslnppkgwkrlapgqrvrlrhayvieled
    vveeggevrllkarivpgtlganpedgvrpkgvihwvsarhalpvefrlygrlfrtkdpe
    eggdflqnlnpealvvkrgfiepsvaqdpedtryqlerlgyfwrdpvdsrpealvmnriv
    plk