PDB entry 5zdi

View 5zdi on RCSB PDB site
Description: Crystal structure of CsaA chaperone protein from picrophilus torridus
Class: chaperone
Keywords: tRNA-binding protein, Chaperone, Thermoacidophiles
Deposited on 2018-02-23, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein secretion chaperonin CsaA
    Species: Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) [TaxId:263820]
    Gene: PTO0409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zdia_
  • Chain 'B':
    Compound: Protein secretion chaperonin CsaA
    Species: Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) [TaxId:263820]
    Gene: PTO0409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zdib_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zdiA (A:)
    mityndfskidirvgiikevsdfkeaikpayklkiyfgdiigyknssaqitnykkdelin
    kkiiavvnfppkqianfisevlvlgaitgdgvklltpdggepgdkia
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zdiB (B:)
    mityndfskidirvgiikevsdfkeaikpayklkiyfgdiigyknssaqitnykkdelin
    kkiiavvnfppkqianfisevlvlgaitgdgvklltpdggepgdkia