PDB entry 5zcz

View 5zcz on RCSB PDB site
Description: Solution structure of the T. Thermophilus HB8 TTHA1718 protein in living eukaryotic cells by in-cell NMR spectroscopy
Class: metal binding protein
Keywords: A putative heavy-metal binding protein, METAL BINDING PROTEIN
Deposited on 2018-02-22, released 2019-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy metal binding protein
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: TTHA1718
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zcza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zczA (A:)
    mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy
    kaevla