PDB entry 5zca

View 5zca on RCSB PDB site
Description: Crystal structure of lambda repressor (1-20) fused with maltose-binding protein
Class: DNA binding protein
Keywords: lambda repressor, maltose-binding protein, DNA binding protein, sugar binding protein
Deposited on 2018-02-16, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Repressor protein cI,Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: malE, b4034, JW3994
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03034 (Start-20)
      • linker (21-23)
    • Uniprot P0AEX9 (24-389)
      • expression tag (390)
    Domains in SCOPe 2.07: d5zcaa1, d5zcaa2
  • Heterogens: MAL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zcaA (A:)
    mstkkkpltqeqledarrlkagsgkieegklviwingdkgynglaevgkkfekdtgikvt
    vehpdkleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwda
    vryngkliaypiavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyf
    twpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaa
    fnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkela
    keflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqm
    safwyavrtavinaasgrqtvdealkdaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zcaA (A:)
    tqeqledarrlkagsgkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkle
    ekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkli
    aypiavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaad
    ggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetam
    tingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyl
    ltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavr
    tavinaasgrqtvdealkdaqtn