PDB entry 5zc7

View 5zc7 on RCSB PDB site
Description: Crystal structure of APRT from Y. pseudotuberculosis with bound adenine (P63 space group).
Class: transferase
Keywords: adenine phosphoribosyltransferase, metal mediated assembly, adenine, TRANSFERASE
Deposited on 2018-02-15, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis serotype I (strain IP32953) [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zc7a_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis serotype I (strain IP32953) [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zc7b_
  • Heterogens: NI, ADE, NA, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zc7A (A:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zc7A (A:)
    sktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvv
    gteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdk
    vlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfd
    gh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zc7B (B:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zc7B (B:)
    ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg
    teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv
    lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg
    h