PDB entry 5zc6

View 5zc6 on RCSB PDB site
Description: Solution structure of H-RasT35S mutant protein in complex with KBFM123
Class: oncoprotein
Keywords: Inhibitor, Complex, Cancer, Small GTPases, ONCOPROTEIN
Deposited on 2018-02-15, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered mutation (34)
  Domains in SCOPe 2.07: d5zc6a_
• Heterogens: GNP, KBF, MG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zc6A (A:)
  mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh