PDB entry 5zbn

View 5zbn on RCSB PDB site
Description: Structure of glycolate oxidase without FMN from Nicotiana benthamiana
Class: oxidoreductase
Keywords: enzyme kinetics, SAXS, oligomerization, OXIDOREDUCTASE
Deposited on 2018-02-12, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolate oxidase
    Species: Nicotiana benthamiana [TaxId:4100]
    Gene: gox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbna_
  • Chain 'B':
    Compound: glycolate oxidase
    Species: Nicotiana benthamiana [TaxId:4100]
    Gene: gox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbnb_
  • Chain 'C':
    Compound: glycolate oxidase
    Species: Nicotiana benthamiana [TaxId:4100]
    Gene: gox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbnc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zbnA (A:)
    meevtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskid
    msttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevast
    gpgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppflt
    lknfegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedar
    lavqagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkala
    lgasgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd
    apraalpaprl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zbnA (A:)
    eevtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidm
    sttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
    pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprliknrfvlppfltlknfegl
    dlgkdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarlavqagaagiiv
    snhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalgasgifigrpv
    vfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewdapraalpaprl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zbnB (B:)
    meevtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskid
    msttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevast
    gpgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppflt
    lknfegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedar
    lavqagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkala
    lgasgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd
    apraalpaprl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zbnB (B:)
    evtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidms
    ttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgp
    girffqlyvykdrnvvaqlvrraeragfkaialtvdtknrfvlppfltlknfegldlgsg
    lasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarlavqagaagiivsnhgarq
    ldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalgasgifigrpvvfslaae
    geagikkvlqmlrdefeltmalsgcrslneitrnhivtewdapraal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zbnC (C:)
    meevtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskid
    msttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevast
    gpgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppflt
    lknfegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedar
    lavqagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkala
    lgasgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd
    apraalpaprl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zbnC (C:)
    vtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidmst
    tvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgpg
    irffqlyvykdrnvvaqlvrraeragfkaialtvdtprlvlppfltlknfeglasyvagq
    idrtlswkdvqwlqtitslpilvkgvltaedarlavqagaagiivsnhgarqldyvpsti
    maleevvkaaqgripvfldggvrrgtdvfkalalgasgifigrpvvfslaaegeagikkv
    lqmlrdefeltmalsgcrslneitrnhivtewd