PDB entry 5zbk

View 5zbk on RCSB PDB site
Description: Crystal strcuture of type-I LOG from Pseudomonas aeruginosa PAO1 in complex with AMP
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-02-12, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: PA4923
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48636
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5zbka_
  • Heterogens: AMP, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zbkA (A:)
    mtlrsvcvfcgaspgaspvyqeaavalgrhlaergltlvygggavglmgtvadaalaagg
    evigiipqslqeaeighkgltrlevvdgmharkarmaeladafialpgglgtlealfevw
    twgqlgyhakplgllevngfydplltfldhlvderfvraehrgmlqrgaspealldalaa
    wtpsvapkwvdrtpqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zbkA (A:)
    tlrsvcvfcgaspgaspvyqeaavalgrhlaergltlvygggavglmgtvadaalaagge
    vigiipqslqeaeighkgltrlevvdgmharkarmaeladafialpgglgtlealfevwt
    wgqlgyhakplgllevngfydplltfldhlvderfvraehrgmlqrgaspealldalaaw
    tp