PDB entry 5zb2

View 5zb2 on RCSB PDB site
Description: Crystal structure of Rad7 and Elc1 complex in yeast
Class: DNA binding protein/ligase
Keywords: LRR, ubiquitin ligase, complex, LIGASE, DNA BINDING PROTEIN-LIGASE complex
Deposited on 2018-02-09, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein RAD7
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RAD7, YJR052W, J1665
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06779 (4-404)
      • expression tag (3)
  • Chain 'B':
    Compound: Elongin-C
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ELC1, YPL046C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zb2b_
  • Heterogens: GOL, PG0, P33, P6G, 9FO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zb2B (B:)
    mgsshhhhhhsqgsmsqdfvtlvskddkeyeisrsaamisptlkagrielkqfdshilek
    aveylnynlkysgvsedddeipefeiptemslelllaadylsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zb2B (B:)
    dfvtlvskddkeyeisrsaamisptlkagrielkqfdshilekaveylnynlkysipefe
    iptemslelllaadylsi