PDB entry 5zau

View 5zau on RCSB PDB site
Description: Complex of the human FYN SH3 and monobody binder
Class: signaling protein
Keywords: Complex, SIGNALING PROTEIN
Deposited on 2018-02-09, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase Fyn
  Species: Homo sapiens [TaxId:9606]
  Gene: FYN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06241 (0-56)
  Domains in SCOPe 2.07: d5zaua_
• Chain 'B':
  Compound: Monobody Binder
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • PDB 5ZAU (0-63)
  Domains in SCOPe 2.07: d5zaub_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zauA (A:)
  tlfvalydyearteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zauB (B:)
  matvkfkykgeekqvdiskivfvtrygkqiffrydlgggkpgfgvvsekdapkellqkle
  kqkk