PDB entry 5zan

View 5zan on RCSB PDB site
Description: Crystal Structure of Aurora-A in complex with a new Quinazoline inhibitor
Class: transferase/inhibitor
Keywords: Drug Design, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2018-02-07, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zana_
  • Heterogens: 9A6

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zanA (A:)
    skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zanA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapssrgtldylppemiegrmhdekvd
    lwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqr
    pmlrevlehpwitanssk