PDB entry 5zai

View 5zai on RCSB PDB site
Description: Crystal strcuture of 3-Hydroxypropionyl-CoA dehydratase from Metallosphaera sedula
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-02-07, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaia_
  • Chain 'B':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaib_
  • Chain 'C':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-258)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaic_
  • Chain 'D':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaid_
  • Chain 'E':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaie_
  • Chain 'F':
    Compound: 3-hydroxypropionyl-coenzyme A dehydratase
    Species: Metallosphaera sedula [TaxId:399549]
    Gene: Msed_2001
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YI89 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5zaif_
  • Heterogens: COA, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zaiA (A:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zaiA (A:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zaiB (B:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zaiB (B:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zaiC (C:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zaiD (D:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zaiD (D:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zaiE (E:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zaiE (E:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zaiF (F:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zaiF (F:)
    mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
    fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
    riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
    vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
    kkegvsaflekreptfk