PDB entry 5za3

View 5za3 on RCSB PDB site
Description: Structure of a C-terminal S. mutans response regulator VicR domain
Class: signaling protein
Keywords: dimer, two component system, SIGNALING PROTEIN
Deposited on 2018-02-06, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Streptococcus mutans [TaxId:1309]
    Gene: covR, A6J86_03970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5za3a_
  • Chain 'B':
    Compound: DNA-binding response regulator
    Species: Streptococcus mutans [TaxId:1309]
    Gene: covR, A6J86_03970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5za3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5za3A (A:)
    peiiigdlqilpdafvakkrgtevelthrefellhhlathtgqvmtrehlletvwgydyf
    gdvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymksyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5za3B (B:)
    peiiigdlqilpdafvakkrgtevelthrefellhhlathtgqvmtrehlletvwgydyf
    gdvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymksyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5za3B (B:)
    peiiigdlqilpdafvakkrgtevelthrefellhhlathtgqvmtrehlletvwgydyf
    gdvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymksy