PDB entry 5za2

View 5za2 on RCSB PDB site
Description: Fox-4 beta-lactamase complexed with avibactam
Class: hydrolase
Keywords: beta-lactamase drug resistance, HYDROLASE
Deposited on 2018-02-06, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: fox-4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5za2a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: fox-4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L387 (0-354)
      • microheterogeneity (57)
    Domains in SCOPe 2.07: d5za2b_
  • Heterogens: NXL, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5za2A (A:)
    ltatvdgiiqpmlkayripgmavavlkdgkahyfnygvanresgqrvseqtlfeigsvsk
    tltatlgayaavkggfelddkvsqhapwlkgsafdgvtmaelatysagglplqfpdevds
    ndkmqtyyrswspvypagthrqysnpsiglfghlaanslgqpfeqlmsqtllpklglhht
    yiqvpesamanyaygyskedkpiratpgvlaaeaygiktgsadllkfveanmgyqgdaal
    ksaialthtgfhsvgemtqglgwesydypvteqvllagnspavsfqanpvtrfavpkamg
    eqrlynktgstggfgayvafvpargiaivmlanrnypiearvkaahailsqlae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5za2B (B:)
    pltatvdgiiqpmlkayripgmavavlkdgkahyfnygvanresgqrvseqtlfeigsvs
    ktltatlgayaavkggfelddkvsqhapwlkgsafdgvtmaelatysagglplqfpdevd
    sndkmqtyyrswspvypagthrqysnpsiglfghlaanslgqpfeqlmsqtllpklglhh
    tyiqvpesamanyaygyskedkpiratpgvlaaeaygiktgsadllkfveanmgyqgdaa
    lksaialthtgfhsvgemtqglgwesydypvteqvllagnspavsfqanpvtrfavpkam
    geqrlynktgstggfgayvafvpargiaivmlanrnypiearvkaahailsqlae