PDB entry 5za0

View 5za0 on RCSB PDB site
Description: A cryo-protectant induces the conformational change of glyceraldehyde-3-phosphate dehydrogenase
Class: oxidoreductase
Keywords: HYPOTHETICAL, OXIDOREDUCTASE, cryo-protectant, glycolysis
Deposited on 2018-02-06, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5za0a1, d5za0a2
  • Heterogens: SO4, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5za0A (A:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5za0A (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk