PDB entry 5z9r

View 5z9r on RCSB PDB site
Description: NMNAT as a specific chaperone antagonizing pathological condensation of phosphorylated tau
Class: transferase
Keywords: antagonizing pathological condensation of phosphorylated tau, CHAPERONE, TRANSFERASE
Deposited on 2018-02-05, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Nmnat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9ra_
  • Chain 'B':
    Compound: Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Nmnat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z9rA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmknripvvllacgsfnpitnmhlr
    lfevardhlhqtgryqviegiispvndsygkkdlvashhrvamarlalqtsdwirvdpwe
    seqaqwmetvkvlrhhhrellrssaqmdgpdpsktpsasaalpelkllcgadvlktfqtp
    nlwkdthiqeivekfglvcvsrsghdperyisdspilqqfqhnihlarepvlneisatyv
    rkalgqgqsvkyllpeavityirdqglyindgswkgkgktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9rA (A:)
    ripvvllacgsfnpitnmhlrlfevardhlhqtgryqviegiispvndsygkkdlvashh
    rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhrellrssaqalpelkllcgadv
    lktfqtpnlwkdthiqeivekfglvcvsrsghdperyisdspilqqfqhnihlarepvln
    eisatyvrkalgqgqsvkyllpeavityirdqglyin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z9rB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmknripvvllacgsfnpitnmhlr
    lfevardhlhqtgryqviegiispvndsygkkdlvashhrvamarlalqtsdwirvdpwe
    seqaqwmetvkvlrhhhrellrssaqmdgpdpsktpsasaalpelkllcgadvlktfqtp
    nlwkdthiqeivekfglvcvsrsghdperyisdspilqqfqhnihlarepvlneisatyv
    rkalgqgqsvkyllpeavityirdqglyindgswkgkgktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9rB (B:)
    ripvvllacgsfnpitnmhlrlfevardhlhqtgryqviegiispvndsygkkdlvashh
    rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhrellrssaqmalpelkllcgad
    vlktfqtpnlwkdthiqeivekfglvcvsrsghdperyisdspilqqfqhnihlarepvl
    neisatyvrkalgqgqsvkyllpeavityirdqglyin