PDB entry 5z9g

View 5z9g on RCSB PDB site
Description: Crystal structure of KAI2
Class: hydrolase
Keywords: alpha/beta hydrolase, HYDROLASE
Deposited on 2018-02-03, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable esterase KAI2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: KAI2, D14L, HTL, At4g37470, F6G17.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9ga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z9gA (A:)
    mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
    yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
    spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
    mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
    ipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9gA (A:)
    gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
    fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
    pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
    rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
    psdghlpqlsspdsvipvilrhirndi