PDB entry 5z91

View 5z91 on RCSB PDB site
Description: Human mitochondrial ferritin mutant bound with gold ions
Class: oxidoreductase
Keywords: Human mitochondrial ferritin, gold, cysteine, METAL BINDING PROTEIN, OXIDOREDUCTASE
Deposited on 2018-02-01, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FTMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z91a_
  • Heterogens: AU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z91A (A:)
    paagpsrvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsr
    eetehaeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhal
    asdkgdphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlgnenk
    qn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z91A (A:)
    srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
    aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg
    dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg