PDB entry 5z88

View 5z88 on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin G228S mutant with 3SLN from A/chicken/Taiwan/0502/2012
Class: viral protein
Keywords: influenza virus, H5N2, VIRAL PROTEIN
Deposited on 2018-01-31, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5Z88
    Domains in SCOPe 2.07: d5z88a1, d5z88a2
  • Heterogens: SIA, GAL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z88A (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvngqssrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z88A (A:)
    gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
    wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
    sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
    hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqssrmeffwtilrpndsi
    tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
    gecpkyvklkklvlatglrniagfieggwqgmvdgwygyhhsneqgsgyaadkestqkav
    dgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmene
    rtldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqysee
    srlkreeidsgl