PDB entry 5z7f

View 5z7f on RCSB PDB site
Description: Horse Heart Myoglobin Mutant -V68A/I107Y-Sulfide Derivative
Class: oxygen storage
Keywords: horse heart myoglobin mutant, V68A/I107Y, sulfide derivative, OXYGEN STORAGE
Deposited on 2018-01-28, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-End)
      • engineered mutation (67)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5z7fa_
  • Heterogens: HEM, H2S, NO2, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z7fA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvaltalggilkkkghheaelkplaqshatkhkipikylefysdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7fA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvaltalggilkkkghheaelkplaqshatkhkipikylefysdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq