PDB entry 5z78

View 5z78 on RCSB PDB site
Description: Structure of TIRR/53BP1 complex
Class: transcription/protein binding
Keywords: DNA repair protein, TRANSCRIPTION-PROTEIN BINDING complex
Deposited on 2018-01-27, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor-interacting repair regulator protein
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VHN8 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5z78a1, d5z78a2
  • Chain 'B':
    Compound: Tudor-interacting repair regulator protein
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z78b_
  • Chain 'C':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12888 (3-122)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5z78c1, d5z78c2, d5z78c3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z78A (A:)
    ghmvpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgf
    pggfvdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleql
    haveisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnm
    mpseklaealasatekqkkalekllppss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z78A (A:)
    mvpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpg
    gfvdrrfwsledglnrvlglggglrlteadylsshltegphrvvahlyarqltleqlhav
    eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmps
    eklaealasatekqkkale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z78B (B:)
    ghmvpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgf
    pggfvdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleql
    haveisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnm
    mpseklaealasatekqkkalekllppss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z78B (B:)
    pelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggf
    vdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhave
    isavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpse
    klaealasatekqkkal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z78C (C:)
    ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
    dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
    glg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z78C (C:)
    hmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipld
    tevtalsedeyfsagvvkghrkesgelyysikegqrkwykrmavilsleqgnrlreqygl
    g