PDB entry 5z6y

View 5z6y on RCSB PDB site
Description: Structure of sfYFP48S95C66BPA
Class: fluorescent protein
Keywords: chromophore linkage electron transfer, FLUORESCENT PROTEIN
Deposited on 2018-01-25, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (2-227)
      • engineered mutation (29)
      • engineered mutation (38)
      • engineered mutation (47)
      • chromophore (64)
      • engineered mutation (65)
      • engineered mutation (94)
      • engineered mutation (102)
      • engineered mutation (108)
      • engineered mutation (125)
      • engineered mutation (145)
      • engineered mutation (163-164)
      • engineered mutation (200)
      • engineered mutation (202-203)
    Domains in SCOPe 2.07: d5z6ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6yA (A:)
    mskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkfisttgklpvpwptl
    vttlxlqcfarypdhmkqhdffksampegyvqercisfkddgkyktravvkfegdtlvnr
    ielkgtdfkedgnilghkleynfnsenvyitadkqkngikanftvrhnvedgsvqladhy
    qqntpigdgpvllpdnhylsdqtvlskdpnekrdhmvllefvtaagitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6yA (A:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkfisttgklpvpwptlvt
    tlxlqcfarypdhmkqhdffksampegyvqercisfkddgkyktravvkfegdtlvnrie
    lkgtdfkedgnilghkleynfnsenvyitadkqkngikanftvrhnvedgsvqladhyqq
    ntpigdgpvllpdnhylsdqtvlskdpnekrdhmvllefvtaagit