PDB entry 5z6q

View 5z6q on RCSB PDB site
Description: Crystal structure of AAA of Spastin
Class: hydrolase
Keywords: Spastin, HYDROLASE
Deposited on 2018-01-25, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spastin
    Species: Homo sapiens [TaxId:9606]
    Gene: SPAST, ADPSP, FSP2, KIAA1083, SPG4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6qa_
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6qA (A:)
    gpgssgavpkrkdplthtsnslprsktvmktgsaglsghhrapsysglsmvsgvkqgsgp
    aptthkgtpktnrtnkpstpttatrkkkdlknfrnvdsnlanlimneivdngtavkfddi
    agqdlakqalqeivilpslrpelftglraparglllfgppgngktmlakavaaesnatff
    nisaasltskyvgegeklvralfavarelqpsiifidevdsllcerregehdasrrlkte
    fliefdgvqsagddrvlvmgatnrpqeldeavlrrfikrvyvslpneetrllllknllck
    qgspltqkelaqlarmtdgysgsdltalakdaalgpirelkpeqvknmsasemrnirlsd
    fteslkkikrsvspqtleayirwnkdfgdttv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6qA (A:)
    nlanlimneivdngtavkfddiagqdlakqalqeivilpslrpelftglraparglllfg
    ppgngktmlakavaaesnatffnisaasltskklvralfavarelqpsiifidevdsllc
    rrlktefliefdgvqsagddrvlvmgatnrpqeldeavlrrfikrvyvslpneetrllll
    knllckqgspltqkelaqlarmtdgysgsdltalakdaalgpirelkpeqvknmsasemr
    nirlsdfteslkkikrsvspqtleayirwnkd