PDB entry 5z6l

View 5z6l on RCSB PDB site
Description: High-pressure Crystal Structure Analysis of M20 loop closed DHFR at 650 MPa
Class: oxidoreductase
Keywords: M20 loop closed form, OXIDOREDUCTASE
Deposited on 2018-01-23, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folA, tmrA, b0048, JW0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (3-161)
      • expression tag (2)
    Domains in SCOPe 2.08: d5z6la1, d5z6la2
  • Heterogens: FOL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5z6lA (A:)
gshmisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgr
kniilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthida
evegdthfpdyepddwesvfsefhdadaqnshsycfeilerr

    Sequence, based on observed residues (ATOM records): (download) 
    >5z6lA (A:)
hmisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkn
iilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaev
egdthfpdyepddwesvfsefhdadaqnshsycfeilerr