PDB entry 5z6h

View 5z6h on RCSB PDB site
Description: Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form
Class: hydrolase
Keywords: Trehalase from insect gut bacterium, apo structure, HYDROLASE
Deposited on 2018-01-22, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: treA, SAMEA2273171_02252
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6ha_
  • Chain 'B':
    Compound: periplasmic trehalase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: treA, SAMEA2273171_02252
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6hb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6hA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefddnpatqttspdillgplfndvqs
    aklfpdqktfadavpksdplmiladyrmqhtqssfdlrhfvemnftlpaegekyvppagq
    slrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyywdsyftmlglaesd
    hwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvellathdsdalkkyrpq
    mekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpeswlddvntaksnpn
    rpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnalmfkmekllarasq
    esgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnqltaaalfplyvka
    aaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwvaaeglqnygqekvs
    mdvtwrflknvqhtydrekklvekydvsttgtgggggeyplqdgfgwsngvtlkmldrvc
    pkakpcdsvpenqpaandevapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6hA (A:)
    qttspdillgplfndvqsaklfpdqktfadavpksdplmiladyrmqhdlrhfvemnftl
    paegekyvppagqslrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyyw
    dsyftmlglaesdhwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvella
    thdsdalkkyrpqmekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpes
    wlddvntaksnpnrpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnal
    mfkmekllarasqesgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnq
    ltaaalfplyvkaaaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwva
    aeglqnygqekvsmdvtwrflknvqhtydrekklvekydvsttgtgggeyplqdgfgwsn
    gvtlkmldrvcpkakpcdsvpenqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z6hB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefddnpatqttspdillgplfndvqs
    aklfpdqktfadavpksdplmiladyrmqhtqssfdlrhfvemnftlpaegekyvppagq
    slrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyywdsyftmlglaesd
    hwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvellathdsdalkkyrpq
    mekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpeswlddvntaksnpn
    rpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnalmfkmekllarasq
    esgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnqltaaalfplyvka
    aaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwvaaeglqnygqekvs
    mdvtwrflknvqhtydrekklvekydvsttgtgggggeyplqdgfgwsngvtlkmldrvc
    pkakpcdsvpenqpaandevapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6hB (B:)
    qttspdillgplfndvqsaklfpdqktfadavpksdplmiladyrmqhdlrhfvemnftl
    paegekyvppagqslrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyyw
    dsyftmlglaesdhwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvella
    thdsdalkkyrpqmekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpes
    wlddvntaksnpnrpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnal
    mfkmekllarasqesgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnq
    ltaaalfplyvkaaaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwva
    aeglqnygqekvsmdvtwrflknvqhtydrekklvekydvsttgtgeyplqdgfgwsngv
    tlkmldrvcpkakpcdsvpenqp