PDB entry 5z6c

View 5z6c on RCSB PDB site
Description: Crystal structure of Bacillus subtilis sugar-binding protein YesO involved in import of rhamnogalacturonan
Class: transport protein
Keywords: ABC transporter substrate-binding protein, sugar transport, TRANSPORT PROTEIN
Deposited on 2018-01-22, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ABC transporter substrate-binding protein YesO
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: yesO, BSU06970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6cA (A:)
    mkkicyvllslvcvflfsgcsageeasgkkedvtlriawwggqprhdyttkvielyekkn
    phvhieaefanwddywkklapmsaagqlpdviqmdtaylaqygkknqledltpytkdgti
    dvssidenmlsggkidnklygftlgvnvlsvianedllkkagvsinqenwtwedyeklay
    dlqekagvygsngmhppdiffpyylrtkgerfykedgtglayqddqlfvdyferqlrlvk
    aktsptpdesaqikgmeddfivkgksaitwnysnqylgfarltdsplslylppeqmqeka
    ltlkpsmlfsipkssehkkeaakfinffvnneeanqlikgergvpvsdkvadaikpklne
    eetniveyvetaskniskadppepvgsaevikllkdtsdqilyqkvspekaaktfrkkan
    eilernn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6cA (A:)
    tlriawwggqprhdyttkvielyekknphvhieaefanwddywkklapmsaagqlpdviq
    mdtaylaqygkknqledltpytkdgtidvssidenmlsggkidnklygftlgvnvlsvia
    nedllkkagvsinqenwtwedyeklaydlqekagvygsngmhppdiffpyylrtkgerfy
    kedgtglayqddqlfvdyferqlrlvkaktsdfivsaitwnysnqylgfarltdsplsly
    lppeqmqekaltlkpsmlfsipkssehkkeaakfinffvnneeanqlikgergvpvsdkv
    adaikpklneeetniveyvetaskniskadppepvgsaevikllkdtsdqilyqkvspek
    aaktfrkkaneilern