PDB entry 5z66

View 5z66 on RCSB PDB site
Description: Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine
Class: hydrolase
Keywords: Trehalase from insect gut bacterium, inhibitor validoxylamine-bound structure, HYDROLASE
Deposited on 2018-01-22, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: treA, SAMEA2273171_02252
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A156C5X3
      • engineered mutation (41)
      • see sequence details (435)
    Domains in SCOPe 2.07: d5z66a_
  • Heterogens: VDM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z66A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefddnpatqttspdillgplfndvqs
    aklfpdqktfadavpksdplmiladyrmqhtqssfdlrhfvemnftlpaegekyvppagq
    slrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyywdsyftmlglaesd
    hwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvellathdsdalkkyrpq
    mekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpeswlddvntaksnpn
    rpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnalmfkmekllarasq
    esgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnqltaaalfplyvka
    aaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwvaaeglqnygqekvs
    mdvtwrflknvqhtydrekklvekydvsttgtgggggeyplqdgfgwsngvtlkmldrvc
    pkakpcdsvpenqpaandevapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z66A (A:)
    tqttspdillgplfndvqsaklfpdqktfadavpksdplmiladyrmqhtqssfdlrhfv
    emnftlpaegekyvppagqslrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrf
    revyywdsyftmlglaesdhwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsm
    mvellathdsdalkkyrpqmekeyaywmdgvdalqpgqankrvvklddgailnrywddrd
    tprpeswlddvntaksnpnrpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivp
    vdlnalmfkmekllarasqesgdaasaskyealatarqkaieshlwndkegwyadydlks
    kkvrnqltaaalfplyvkaaaqdradkvaaatssrllkpggiatttvnsgqqwdapngwa
    plqwvaaeglqnygqekvsmdvtwrflknvqhtydrekklvekydvsttgtgggggeypl
    qdgfgwsngvtlkmldrvcpkakpcdsvpenq